top of page

CircRNA

Gene

chr9|85822879|85829606|+|2|circRNA|RP11-213G2.3|NR_029410|3,4

RP11-213G2.3

Open Reading Frame (ORF)

LEVKELKNQVQMMVQENKGHAVSLKEAQKVNRLQLQLWRAKRVSFFELFKKYFKASLNILALTLM

Peptide

YFKASLNILALTLM

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page