top of page

CircRNA

Gene

chr9|85596361|85655320|-|8|circRNA|AGTPBP1|NM_001286715|17,16,15,14,13,12,11,10

AGTPBP1

Open Reading Frame (ORF)

MPDHGGFVWGLTFVTIRMSGSQDSGSSCQYLQSDNEEVFPKKSTATPNN

Peptide

MPDHGGFVWGLTFVTIR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page