top of page

CircRNA

Gene

chr9|83891294|83908652|-|4|circRNA|KIF27|ENST00000297814.6|6,5,4,3

KIF27

Open Reading Frame (ORF)

MGQMPGSLKGDHILYHLILIWGIIFISHQDKIPGSFSCGGPKGYHSSSYSRNISKHL

Peptide

MGQMPGSLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page