top of page

CircRNA

Gene

chr9|37424844|37432138|+|7|circRNA|GRHPR|ENST00000318158.10|2,3,4,5,6,7,8

GRHPR

CircRNA UID

circGRHPR(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

LYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCAVRWSSGTRMSPSLPRS

Peptide

MSPSLPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page