top of page

CircRNA

Gene

chr9|33924284|33926616|-|1|ciRNA|UBAP2|ENST00000379239.8|6

UBAP2

Open Reading Frame (ORF)

LWGQRGIGPLLALPMGRTSSWEPLSSCSAISQGTCQRVAGSLDTTSAGYSLSCCWRKRLSPLCSDAFFPVGVAPFSAAPQRADGAALVSEE

Peptide

GIGPLLALPMGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page