top of page

CircRNA

Gene

chr9|19290703|19300331|+|5|circRNA|DENND4C|ENST00000434457.6|5,6,7,8,9

DENND4C

Open Reading Frame (ORF)

LLMNLGPENCATLLLFVLLESKILLHSLRPAVLTGVAEAVVAV

Peptide

ILLHSLRPAVLTGVAEAVVAV

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page