top of page

CircRNA

Gene

chr9|14639895|14674385|-|5|circRNA|ZDHHC21|ENST00000380916.8|8,7,6,5,4

ZDHHC21

Open Reading Frame (ORF)

LASSQIILPCGLAGSYKIAKWVSGFTLLLTHMVGAAWV

Peptide

LASSQIILPCGLAGSYK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page