top of page

CircRNA

Gene

chr9|14120439|14307520|-|7|circRNA|NFIB|NM_001190737|8,7,6,5,4,3,2

NFIB

Open Reading Frame (ORF)

MYLLMTHPVHKPARMNFTHSSRHFFHMSVQLPILGSTCRLENASTLKSMRSECQRMKKEQSKMSFSVKSLKSNRSGHPGSLPNCAKIFARSIERTLCSP

Peptide

MYLLMTHPVHKPAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page