top of page

CircRNA

Gene

chr9|137297256|137298789|+|2|circRNA|Unknown|T370099|2,3

Unknown

CircRNA UID

circUnknown(2,3).J

Open Reading Frame (ORF)

LWPLSFPTAGHSRAGPGQDFPKPASGSWPISQADSAG

Peptide

LWPLSFPTAGHSR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page