top of page

CircRNA

Gene

chr9|136394248|136395770|-|4|circRNA|SNAPC4|NM_003086|6,5,4,3

SNAPC4

Open Reading Frame (ORF)

LLRKSVVSDRLQRLLQPKLLKKKKGGAKPAMTRTIPRIKPSLKTQKPACS

Peptide

KGGAKPAMTR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page