top of page

CircRNA

Gene

chr9|131430089|131459356|+|10|circRNA|PRRC2B|ENST00000405995.5|2,3,4,5,6,7,8,9,10,11

PRRC2B

Open Reading Frame (ORF)

LQTVRTLSGLERKGRTGLKQWVRPVWSERRQTLSHRPGSFMAGHQALTTRQIGSGAEKNFLTR

Peptide

QTLSHRPGSFMAGHQALTTRQIGSGAEK

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page