top of page

CircRNA

Gene

chr9|128635788|128636280|-|1|ciRNA|WDR34|ENST00000372715.6|4

WDR34

CircRNA UID

ciWDR34(4)

Open Reading Frame (ORF)

LLCPPPLLSGLSFPPCRGHKGAFHGPFGPETGRRALTLSVWSPGEGLQ

Peptide

ALTLSVWSPGEGLQ

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page