top of page

CircRNA

Gene

chr9|128508875|128515639|+|2|circRNA|GLE1|NM_001499|2,3

GLE1

Open Reading Frame (ORF)

LRPNVRTGTQNERNRCFRRMYVSSQAIFLFWMGGRARPTPYAGEPTSV

Peptide

TGTQNERNR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page