top of page

CircRNA

Gene

chr9|128101095|128107179|+|8|circRNA|SLC25A25|NM_001006641|2,3,4,5,6,7,8,9

SLC25A25

Open Reading Frame (ORF)

LAAALCSEQRGPRRVCAPGLWHHVQYLWPAGQLPPGPSQDPDAGARKLYKLEIRTLMGS

Peptide

LAAALCSEQRGPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page