top of page

CircRNA

Gene

chr9|123179006|123184298|-|2|circRNA|STRBP|NM_018387|4,3

STRBP

Open Reading Frame (ORF)

MRPEKTIPSVFQRTSLQTFAILTLSCQGTQAYEEVLLHKTVSSEDDKKEGKGSEKEAKIL

Peptide

MRPEKTIPSVFQR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page