top of page

CircRNA

Gene

chr9|120960247|120963738|-|5|circRNA|C5|ENST00000223642.2|38,37,36,35,34

C5

Open Reading Frame (ORF)

LQRQENKQHVNQRLHMLQAQQGRIIIWILSCGDGHLLAYWNQCK

Peptide

LHMLQAQQGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page