top of page

CircRNA

Gene

chr9|104806240|104812722|-|4|circRNA|ABCA1|ENST00000374736.7|31,30,29,28

ABCA1

Open Reading Frame (ORF)

MDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQNPERQTCSVGWMAKGPTR

Peptide

KMLPVCPPGAGGLPPPQNPER

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page