top of page

CircRNA

Gene

chr8|94526222|94531085|-|3|circRNA|KIAA1429|ENST00000297591.9|8,7,6

KIAA1429

Open Reading Frame (ORF)

MGNSFRRNSKFNNKRVKLFAIEKHKTRLPWPVGRLDHASFKFTSSASPTYRLKCSTAQSWDQISVLTSRMWGSRSYRTATSRSDQWII

Peptide

LFAIEKHK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page