top of page

CircRNA

Gene

chr8|94378179|94404239|-|9|circRNA|RAD54B|ENST00000611249.1|12,11,10,9,8,7,6,5,4

RAD54B

Open Reading Frame (ORF)

MKVQIVLLMICLTVSVQEKKFIQIPSLCHDQIRITSGYSIRTVSLLWM

Peptide

TVSLLWM

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page