top of page

CircRNA

Gene

chr8|89611433|89617156|-|3|circRNA|RP11-37B2.1|TCONS_l2_00028293|4,3,2

RP11-37B2.1

Open Reading Frame (ORF)

LLTQHDSASVLPLTHGAPNRGELVSQIDWKTNPHEARKRNEAAVAESIAGLNDAG

Peptide

NEAAVAESIAGLNDAG

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page