top of page

CircRNA

Gene

chr8|8376246|8381834|-|2|circRNA|SGK223|ENST00000615670.4|3,2

SGK223

Open Reading Frame (ORF)

LESSVPDRGRRGGGAGIAESQLGKRDQKWPHGPFKLHDLAPSPPHRWLLWAEQQSWDRDEQIRLFCL

Peptide

RGGGAGIAESQLGK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page