top of page

CircRNA

Gene

chr8|78686466|78715328|+|5|circRNA|ZC2HC1A|NM_016010|4,5,6,7,8

ZC2HC1A

Open Reading Frame (ORF)

LARNPAPGVLTNKRKTYTESYIASQNHQRNHLIGEGNMKNSLLP

Peptide

NHLIGEGNMK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page