top of page

CircRNA

Gene

chr8|55941854|55953984|+|7|circRNA|LYN|ENST00000519728.5|2,3,4,5,6,7,8

LYN

Open Reading Frame (ORF)

MACAEDWRRLVLVPSHRSHGIKMPGRSPGSPSSW

Peptide

LVLVPSHRSHGIK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page