top of page

CircRNA

Gene

chr8|51831443|51833689|-|2|circRNA|PCMTD1|ENST00000544451.2|3,2

PCMTD1

Open Reading Frame (ORF)

LDRTLGKVKISLLFHLLHLCNQVRMIMANQILWDSI

Peptide

ISLLFHLLHLCNQVRMIMANQILWDSI

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page