top of page

CircRNA

Gene

chr8|47673800|47713641|+|6|circRNA|SPIDR|ENST00000297423.8|11,12,13,14,15,16

SPIDR

Open Reading Frame (ORF)

LLQKPLLSVVSGASSCELPGPVMLDSLDSATPVNSICSVQEPAFWYKMPVECSVKCTWSSPCRRQDSWKGSLAAWWE

Peptide

CTWSSPCRR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page