top of page

CircRNA

Gene

chr8|37431131|37476012|-|4|circRNA|LINC01605|NR_121620|5,4,3,2

LINC01605

Open Reading Frame (ORF)

MRGDGDFQLIPVTNSRPSYRVQVPSAWPGRTISLCLPLPLALTCLPLNMHFA

Peptide

GDGDFQLIPVTNSRPSYRVQVPSAWPGR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page