top of page

CircRNA

Gene

chr8|27656781|27659539|+|2|circRNA|SCARA3|ENST00000337221.8|4,5

SCARA3

Open Reading Frame (ORF)

MKLGSWGQRSENCRRSWREFRSCFWPRRCSWTRPYRPRRCSPPPADKSPRRWAVAPSPSTRLTSLWGSSWPR

Peptide

RWAVAPSPSTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page