top of page

CircRNA

Gene

chr8|25341809|25342400|+|1|ciRNA|DOCK5|NM_024940|24

DOCK5

Open Reading Frame (ORF)

LLPCHKLSGHFVVFQVNLSMPKSQSGGEKFIMMPSIWQNEDTTNPEVSLPGK

Peptide

LSGHFVVFQVNLSMPK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page