top of page

CircRNA

Gene

chr8|132794409|132794817|+|2|circRNA|PHF20L1|NM_198513|3,4

PHF20L1

Open Reading Frame (ORF)

LARWTDCRYYPAKIEAINKEGIHHELKKLTMRRARCWSILSAGVIVMMSGFTGIAIDCDPLRDQH

Peptide

CWSILSAGVIVMMSGFTGIAIDCDPLR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page