top of page

CircRNA

Gene

chr8|127890588|127890998|+|1|circRNA|PVT1|NR_003367|2

PVT1

Open Reading Frame (ORF)

LWLNASWILTAWMSMGDEGLQLAERVEISVYLDLCQLPLGLPMECKTPTLPGEASDARSIRRSAGLEA

Peptide

TPTLPGEASDARSIR

ORF Found in Long-Read

true

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page