top of page

CircRNA

Gene

chr8|123778658|123809016|+|17|circRNA|FAM91A1|ENST00000521166.5|6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22

FAM91A1

Open Reading Frame (ORF)

LCFGIPLFSSELNRKVCRKIAAHGLCRKERNSSEGKQPVIFYQ

Peptide

NSSEGKQPVIFYQ

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page