top of page

CircRNA

Gene

chr8|100527844|100533311|-|3|circRNA|ANKRD46|ENST00000520552.5|4,3,2

ANKRD46

Open Reading Frame (ORF)

LAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESERSLPAHYRIFLLNLLENSEKLLSDH

Peptide

LETMQTAESERSLPAHYR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page