top of page

CircRNA

Gene

chr7|99045697|99054865|-|6|circRNA|SMURF1|NM_001199847|11,10,9,8,7,6

SMURF1

Open Reading Frame (ORF)

MKMRPKDLKKRLMVKFRGEEGLDYGGVASQFTDTRQNRNRRLGGGLQRTVRK

Peptide

GEEGLDYGGVASQFTDTR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page