top of page

CircRNA

Gene

chr7|93291702|93297243|+|4|circRNA|CCDC132|ENST00000305866.9|13,14,15,16

CCDC132

Open Reading Frame (ORF)

LEKNFVVASLKFYRNLLENKVSIISRITIACYTRQLYSMPCRPVQSTMGSYAQLL

Peptide

ITIACYTR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page