top of page

CircRNA

Gene

chr7|83134249|83135656|-|1|circRNA|PCLO|NM_033026|3

PCLO

CircRNA UID

circPCLO(3)

Open Reading Frame (ORF)

MALLQPRPSSPLRQILCPSQPLPKNLLSHLSRTRPLLLMINQSSPRW

Peptide

TRPLLLMINQSSPRW

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page