top of page

CircRNA

Gene

chr7|77585542|77627675|+|9|circRNA|PTPN12|ENST00000248594.10|5,6,7,8,9,10,11,12,13

PTPN12

Open Reading Frame (ORF)

LCGLQCNTIKQSFSYSTRRIPEFRHTSKARPLAS

Peptide

IPEFRHTSK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page