top of page

CircRNA

Gene

chr7|77583554|77600806|+|5|circRNA|PTPN12|ENST00000248594.10|4,5,6,7,8

PTPN12

Open Reading Frame (ORF)

MKMFLFVFIAGRLWAKSICSNSRTFSKYSNRFLEDDMGV

Peptide

SICSNSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page