top of page

CircRNA

Gene

chr7|740818|741465|+|2|circRNA|DNAAF5|ENST00000297440.10|3,4

DNAAF5

Open Reading Frame (ORF)

LAASLWEDVGLQWQKENEEDLKDKLDFAPPTPPHYPPHGPAGGGLRGGRLAAVSA

Peptide

DKLDFAPPTPPHYPPHGPAGGGLR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page