top of page

CircRNA

Gene

chr7|5603495|5604030|+|2|circRNA|FSCN1|NM_003088|3,4

FSCN1

CircRNA UID

circFSCN1(3,4)

Open Reading Frame (ORF)

MKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKGMPAATLTSSGVTGASH

Peptide

GMPAATLTSSGVTGASH

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page