top of page

CircRNA

Gene

chr7|47368364|47369621|-|1|circRNA|TNS3|ENST00000311160.13|17

TNS3

Open Reading Frame (ORF)

MALCLQTAWEVGSGQAAGCLTQERAPAGPPGGKCYTRRALSMAAFTRR

Peptide

APAGPPGGKCYTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page