top of page

CircRNA

Gene

chr7|36406180|36427028|+|16|circRNA|ANLN|NM_001284301|4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19

ANLN

Open Reading Frame (ORF)

MASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKMTFLKAHSSHQCHQRKRLLPLPDLCFQMPRQLQLAEGAVWPILLQLFAPGKMM

Peptide

FVLDKMTFLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page