top of page

CircRNA

Gene

chr7|158679959|158689953|-|6|circRNA|NCAPG2|NM_001281932|12,11,10,9,8,7

NCAPG2

Open Reading Frame (ORF)

LKFDQMLHCCLLKHFLLGIQTFMLLKWIVKSRNSLKSSMVQTYVGFGVSIKLYIALIMIWRKVEKLKICYLSAS

Peptide

FDQMLHCCLLKHFLLGIQTFMLLK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page