top of page

CircRNA

Gene

chr7|150957290|150959736|-|3|circRNA|KCNH2|NM_000238|5,4,3

KCNH2

Open Reading Frame (ORF)

MSLRRSPRELLPMSGGCGAREERGWGCHHVHPQFRGGDGEGHGGVPGS

Peptide

ELLPMSGGCGAREER

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page