top of page

CircRNA

Gene

chr7|140776911|140787584|-|5|circRNA|BRAF|NM_004333|13,12,11,10,9

BRAF

Open Reading Frame (ORF)

MGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMET

Peptide

LIDIARQTAQGMET

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page