top of page

CircRNA

Gene

chr7|140034234|140057153|-|6|circRNA|PARP12|ENST00000263549.7|8,7,6,5,4,3

PARP12

CircRNA UID

circPARP12(8,7,6,5,4,3)

Open Reading Frame (ORF)

MDPTALVPFKSSASSSISASIFYRGNASLALAVRDPMISLILRIWKNWRSWV

Peptide

GNASLALAVRDPMISLILR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page