top of page

CircRNA

Gene

chr7|131429032|131464408|+|6|circRNA|MKLN1|ENST00000421797.6|10,11,12,13,14,15

MKLN1

Open Reading Frame (ORF)

MIKLQRIIQLKVFRKKNHVQGLPISLYTMSYTRDCLFVWWLGWNTRSC

Peptide

NHVQGLPISLYTMSYTR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page