top of page

CircRNA

Gene

chr7|128591849|128609579|+|3|circRNA|RP11-274B21.14|TCONS_l2_00026190|4,5,6

RP11-274B21.14

Open Reading Frame (ORF)

MTSSTAPLWFRWQCCKGGNRGAVCSANPHVSDASKTSA

Peptide

GGNRGAVCSANPHVSDASK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page