top of page

CircRNA

Gene

chr7|117734912|117746099|-|4|circRNA|CTTNBP2|ENST00000160373.7|16,15,14,13

CTTNBP2

Open Reading Frame (ORF)

LLSDGNHRQGLSPGLRLAGAAAFPLGAAAVGWRAHARTAAEVLTKESCE

Peptide

TAAEVLTKESCE

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page