top of page

CircRNA

Gene

chr7|10982371|10983159|+|1|circRNA|PHF14|ENST00000403050.7|3

PHF14

Open Reading Frame (ORF)

LRLRKREVMETMRMMKMREAGVMKTRMMKAMMKIIVALPVKGVARRRRVKFLAETVLMMRN

Peptide

AMMKIIVALPVK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page