top of page

CircRNA

Gene

chr7|100856867|100859161|+|3|circRNA|SLC12A9|ENST00000540482.5|5,6,7

SLC12A9

Open Reading Frame (ORF)

LKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRCHRAQWAPGPAPGLRLEPAVWLPAAGPCGWGLHPGSRPLCPGLIPHIPAGLWLPGLCAHQFCGCGAEGHPLDS

Peptide

AQWAPGPAPGLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page